PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G198700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family SAP
Protein Properties Length: 449aa    MW: 49633.8 Da    PI: 6.5679
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G198700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP655.77.3e-20014461454
                 SAP   1 mssssssssseseegseggeggdass....gesegpsssrqraanevwpePflealatqvaidasrslGrlaaasalanvfqvcstwravs 87 
                         mss+s+ssss+s++g+++ ++ + s+    g++egpsssr+ra+nevwpePf+ealatqvaidasrs+Grlaaa+alanvfq+cstwravs
  Prupe.3G198700.1.p   1 MSSPSTSSSSSSQDGNHSANAAGPSNvqrgGDFEGPSSSRRRAVNEVWPEPFVEALATQVAIDASRSMGRLAAAPALANVFQICSTWRAVS 91 
                         7887777777777777777766665566779************************************************************ PP

                 SAP  88 rsdllwqrltrriWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsCrclalsdkylaaGfadGavrlfdle 178
                         rsdllw+rltr +W rt+ll+dtWr+ey+y+hrtarnf+trr+ ++tl fdp+dv+++   + ++Crcl+lsd +la+GfadGavr+f+l+
  Prupe.3G198700.1.p  92 RSDLLWHRLTRLVWGRTRLLQDTWRDEYVYWHRTARNFQTRRSVHTTLYFDPSDVEDS---NGFTCRCLTLSDAHLACGFADGAVRVFHLD 179
                         *****************************************************99885...56**************************** PP

                 SAP 179 trlhvstflpqhrdrlGrfsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGraf 269
                         trlhv+tf+p+ rdrlG+fsrav+Givi+ds+lvfatldGdihva+i +     +rr++lG+vvndGalvdf+G++r+wvGlyaGvpGraf
  Prupe.3G198700.1.p 180 TRLHVNTFRPHLRDRLGPFSRAVTGIVITDSKLVFATLDGDIHVAIIGI--PQITRRVHLGEVVNDGALVDFTGCERFWVGLYAGVPGRAF 268
                         *************************************************..679************************************* PP

                 SAP 270 hiWdaeteelvfvGGsltdPeavmGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeer..rGlivssldasneayv 358
                         hiWd+ te+l+fvGG+ltdPe                 vrvt+re+avaCts+r++vfdl nqg+vl++ee r  r +iv+s+d+s+ ayv
  Prupe.3G198700.1.p 269 HIWDGVTEQLTFVGGTLTDPEG----------------VRVTSRESAVACTSSRVMVFDLTNQGLVLGDEEYRngREIIVTSVDVSSAAYV 343
                         ********************97................69*******************************995566************** PP

                 SAP 359 vvdsr.Gv......atvrrvenleevcrfrvrg.aqrgvlgCvnggyalvyaggvlrvWeiekkegylyslrervgevnalvaddrhvavs 441
                         ++++r G       a+vr+v+++eevcrf+vrg a+ + +gC+n gyal+++ gv+ vWe+e+ + yly +rer+g+vna+v d+rhva++
  Prupe.3G198700.1.p 344 IAERRrGLarlarlARVRQVDTMEEVCRFNVRGaAEMEAMGCMNEGYALMCTDGVVSVWEVERGA-YLYRFRERIGDVNAMVCDERHVAAC 433
                         **97537522222267999**************9999**************************77.************************* PP

                 SAP 442 ssdgtihlldfga 454
                         ssd+t+hl+dfga
  Prupe.3G198700.1.p 434 SSDTTLHLWDFGA 446
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.1280.506.6E-676143No hitNo description
SuperFamilySSF813831.5E-676124IPR001810F-box domain
Gene3DG3DSA:2.130.10.101.0E-13151219IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509789.34E-15152339IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.101.0E-13267444IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509789.34E-15387443IPR017986WD40-repeat-containing domain
PROSITE profilePS502949.494396448IPR017986WD40-repeat-containing domain
PROSITE patternPS006780430444IPR019775WD40 repeat, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MSSPSTSSSS SSQDGNHSAN AAGPSNVQRG GDFEGPSSSR RRAVNEVWPE PFVEALATQV  60
AIDASRSMGR LAAAPALANV FQICSTWRAV SRSDLLWHRL TRLVWGRTRL LQDTWRDEYV  120
YWHRTARNFQ TRRSVHTTLY FDPSDVEDSN GFTCRCLTLS DAHLACGFAD GAVRVFHLDT  180
RLHVNTFRPH LRDRLGPFSR AVTGIVITDS KLVFATLDGD IHVAIIGIPQ ITRRVHLGEV  240
VNDGALVDFT GCERFWVGLY AGVPGRAFHI WDGVTEQLTF VGGTLTDPEG VRVTSRESAV  300
ACTSSRVMVF DLTNQGLVLG DEEYRNGREI IVTSVDVSSA AYVIAERRRG LARLARLARV  360
RQVDTMEEVC RFNVRGAAEM EAMGCMNEGY ALMCTDGVVS VWEVERGAYL YRFRERIGDV  420
NAMVCDERHV AACSSDTTLH LWDFGAAD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007217836.10.0hypothetical protein PRUPE_ppa025801mg
SwissprotQ9FKH11e-171SAP_ARATH; Transcriptional regulator STERILE APETALA
TrEMBLM5XJ310.0M5XJ31_PRUPE; Uncharacterized protein
STRINGAl_scaffold_0007_31721e-169(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF76873146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-169SAP family protein